TToday.net
Traffic information about domains and websites
 

phillymanagedservice.net

( ID of domain listed above: 3966503 )

On TToday.net you can find free data about domain names that has been expired.

In the domain report there will be estimated traffic information as well as evaluation report, various ranks analysed, SEO reports, content analysis, DNS records, WHOIS information and even more!

Below is browsable list of all dropped domain names that we have in our database.

If you want to find a report about domain name that is not included in this page, just use search function, which is on the top of the page.

Below you can find these records:

  • from: ID: 39665030 headachespainreliefcastlehill.com
  • to: ID: 39665039 headachepainreliefbaulkhamhills.com
IDDomain nameDate of deletionOther expiry dates
39665030headachespainreliefcastlehill.comJune 7, 2015
3,312 days ago
-
39665031headachespainreliefbellavista.comJune 7, 2015
3,312 days ago
-
39665032headachespainreliefbaulkhamhills.comJune 7, 2015
3,312 days ago
-
39665033headachesduringpregnancyreliefcastlehill.comJune 7, 2015
3,312 days ago
-
39665034headacheremediescastlehill.comJune 7, 2015
3,312 days ago
-
39665035headachereliefcastlehill.comJune 7, 2015
3,312 days ago
-
39665036headachepainreliefkellyville.comJune 7, 2015
3,312 days ago
-
39665037headachepainreliefcastlehill.comJune 7, 2015
3,312 days ago
-
39665038headachepainreliefbellavista.comJune 7, 2015
3,312 days ago
-
39665039headachepainreliefbaulkhamhills.comJune 7, 2015
3,312 days ago
-

 
SERVER: 13