TToday.net
Traffic information about domains and websites
 

otomotocikma.com

( ID of domain listed above: 437509 )

On TToday.net you can find free data about domain names that has been expired.

In the domain report there will be estimated traffic information as well as evaluation report, various ranks analysed, SEO reports, content analysis, DNS records, WHOIS information and even more!

Below is browsable list of all dropped domain names that we have in our database.

If you want to find a report about domain name that is not included in this page, just use search function, which is on the top of the page.

Below you can find these records:

  • from: ID: 4375090 tampalanguageservices.com
  • to: ID: 4375099 tammystopsecretvideo.com
IDDomain nameDate of deletionOther expiry dates
4375090tampalanguageservices.comJune 13, 2016
2,917 days ago
-
4375091tampaintegrativepodiatry.comJune 13, 2016
2,917 days ago
-
4375092tampaholisticpodiatry.comJune 13, 2016
2,917 days ago
-
4375093tampafamilydentistdentalservices.comJune 13, 2016
2,917 days ago
-
4375094tampacondoadvisor.comJune 13, 2016
2,917 days ago
-
4375095tampaconcretesolutions.comJune 13, 2016
2,917 days ago
-
4375096tampabaiters.comJune 13, 2016
2,917 days ago
-
4375097tampa5bay.comJune 13, 2016
2,917 days ago
-
4375098tamoudatetouan.comJune 13, 2016
2,917 days ago
-
4375099tammystopsecretvideo.comJune 13, 2016
2,917 days ago
-

 
SERVER: 51